GenomeNet

>ssc:100625897 K01229 lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62] | (RefSeq) LOW QUALITY PROTEIN: lactase-phlorizin hydrolase (A)
MELAWHLVSIVLLSFSCWGLDWESDRNFILAAGPLTTDLLYDLRGPLGHQDSHFGAGDKG
IYVCRQPLPAFLPEYFSSVHASMITHYKVFLPWAQLLPEGSSKNPDKRMVQCYRQLLEAL
ETAQLQPLVVLHHQTLPASTVQRSEAFADLFADYASFVFHSFGDLVKIWFTFSDLEEVIT
ELPHQESRASHLQILAEAHRKAYEIYHEKYSSQGGKLSVVLQAEAVSQLLTEPSTSVLAK
DAVDFLSLDLSSECQESETSLPQKLRKLQTIEPNVKLFIFSLKLQDCLSTRKNPADVLFS
LLKALNEDQVFTIGFDIHTFLSCSSSSKKSRSCSLTDNLTLQAALQLDPETAVDSSPPRS
AYQAVWETFANQSRAERDALLQGVFPEGFLWGVSTGAFNVEGGWAEDGRGASIWDXTRAP
GHRQGQATPEVASDSYHKVDTDVALLRGLRAQVYKFSISWSRIFPSGQGHSPNLQGVAYY
NKLIDSLLDSHIEPMATLFHWDLPQALQDRGGWQNESVVDAFLDYAAFCFSTFGDRVKMW
VTFHEPWVMSYAGYGTGQHAPGISDPGVASFKVAHLVLKAHARAWHHYNSHHRPRQQGRV
GIVLNSDWAEPLSPERPEDLRASERFLHFMLGWFAHPIFVDGDYPATLRAQVQRVNQGCP
SPVAQLPEFTEVEKQLLKGSADFLGLSHYTSRLISKAHQDTCIPSYDTIGGFSQHVDPTW
PQTASPWIRVVPWGVRRLLRFVSLEYTRGKVPIYLAGNGMPIGDGEDLLHDSSRVTYFNQ
YINEVLKAVKEDSVDVRSYIARSLLDGFEGPSGYSQRFGLYHVNFNDSSRSRTPRKSAYF
LTSMIEKNSLLSKAVKEQPPSSRADIPQKIRAFAFPSEVPSKAKVVWEKFSNQPKFERDL
FYHGTFRDDFLWGVSSSAYQIEGAWDADGKGPSIWDNFTHTPGSNVKDNATGDVACDSYN
QLDADLNMLRALKVKAYRFSISWSRVFPTGRNSSINTRGVDYYNRLIDGLVASNISPMVT
LFHWDLPQALQDIGGWENPALTELFNSYADFCFQTFGDRVKFWMTFNEPTYQAWLGYGSG
DFPPNVKDPGSGPYRIGHAILKAHATVYHTYDEKYRQEQKGVISLSLSTHWAEPQSPGVP
RDVEAADRMLQFSLGWFAHPIFRNGDYPDAMKWKVGNRSELQHLATSRLPSFTEQEKAYI
RATADVFCLNTYSSRIVRHATPRLNPPSYEDDQELTEEEDPSWPSTAVNRAASWGMRRLL
NWIKEEYGDIPIYITENGVGLTDPGVEDTDRIFYHKTYINEALKAYRLDGVDLRGYAAWS
LMDNFEWLNGYTVKFGLYHVDFNNVNRPRTARASARYYTEVITNNGMPLPAEDEFLYGQF
PEGFIWSAATAAYQIEGAWRADGKGLSIWDTFSHTPLKIENNDIGDMACDSYHKIAEDVV
ALQNLGVSHYRLSISWTRILPDGTTKYINEAGLDYYVRLIDALLAANIQPQVTIYHWDLP
QALQDVGGWENETIVQRFKEYADVLFQRLGDKVKFWITLNEPFVVAQQGYGSGTFAPGIS
SRPGTAPYIVGHNLIKAHAEAWHLYNDVYRASQGGVISITINSDWAEPRDPSNQEDVEAA
RRYVQFMGGWFSNPIFKNGDYPEVMKTRIRDRSLAAASTSLGCPSSQRVRRGGSMAPMTF
LGSITTPLSWPTISTLTLPSPPLKRTGEWPRLQIALGQTLAPSG

BLAST