GenomeNet

>ssc:100627559 no KO assigned | (RefSeq) HDAC7; LOW QUALITY PROTEIN: histone deacetylase 7 (A)
MHNPGADGTQVSPGAHGPSLPGTGCPRPRTDTPGPQPQPMDLRVGQRPLVEPPPEPSLLA
LQHTQRLPHHLFLGAVQPQRSVEPMRLSMDTMPELQVGQQEQELRQLLNKDKSKRSAVAS
SVVKQKLAEVILKKQQAALEKTVHPNSPSVPYRTLEPLETEGAARSMLSSFLPPVPSLPS
DPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSS
STPASGCSSPNDSEHGPNPVLGSEALLGQRLRLQETSLAPFALLPTITLGLPAPARADGD
RRTHPTLGPRGPVLGXPHAPLFLPHGLEPEAGGPLPSRLQPILLLDPSVSHAPLLTVPGL
GPLPFHFAQSLMTSERLSGSGLHRPLSRTRSEPLPPSAPLGALQPRLERLKPHVQLIKRP
AKPSEKPRLRQIPSAEDLETDAGGLGPVGEDGLEHRESSHGQHEARGPVPLQQHQQVFLW
EQQRLAGRLPRGGAGDPVLLPLAQGGHRPLSRAQSSPAAPASLPTPEPPSQARVLPSSET
PTRTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLLERGLRSQCESLRGRK
ASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNE
LHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQ
LQQQGKAGKILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGS
GEGFNVNVAWAGGLDPPMGDPEYLAAFRTVVMPIAREFSPDLVLVSAGFDAAEGHPPPLG
GYHVSAKCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDPLSEEG
WKQKPNLNAIRSLEAVIRVHSEYWGCMQHLASCPDSWVPRVPGADAEEVEAVTALASLSV
GILAEERTSVQLVEEEEPMNL

BLAST