GenomeNet

>ssc:613133 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) ACE; angiotensin-converting enzyme isoform 1 precursor (A)
MGQGWAAPGLPCLLLLLLLCCGRPLLVPGQGTTSQVTDIQRTTSQATTSGQATTSSQATT
SSQTTTSHSTTSSLKTQSPNLVSDEAEASKFVEEYDRRSQVVLNEYAEANWDYNTNITAE
GSKRVLEKSTQMANHTVKYGIWARKFDVANIQNFTLKRMIKKIQDLERAALPFKELEEYN
QILLDMETAYSVASVCHANSTCLQLEPDLTNLMATSRSYEELLWAWKGWRDKVGRAILPY
FPKYVELTNKAARLNGYEDGGDAWRAAYEMPFLEQELEQLFQELQPLYLNLHAYVRRALH
HHYGPEHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSASKMDASEAMINQGWTPQRMF
KEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFFNGKDFRIKQCTTVNME
DLVVAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALSVSTPKHLRSINLLKSE
DDGYEEDINFLMKMALDKVAFVPFSYLVDQWRWRVFDRSITKENYNQEWWSLRLKYQGLC
PPVARSQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHKGPLHKCDIYQSK
EAGRRLADAMKLGLSKPWPEAMQLITGQPNVSASAMMTYFKPLLDWLVTENGRHGEKLGW
PQYNWTPNSARLEGSFAGTGRVNFLGLNLEEQQARVGQWVLLFLGVTLLVATMGLTQRLF
SIRHQILRRTHRGPQFGSEVELRHS

BLAST