GenomeNet

>ssc:780433 Fp, SDHA; succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFV
EYFALDLLMENGECRGVIALCIEDGSIHRI

BLAST