GenomeNet

>ssc:780433 SDHA, Fp; succinate dehydrogenase complex, subunit A, flavoprotein (Fp); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MDAVDEGCGRAMWRVVRQHQECLWELRWCPRADRACPGAPASKAPCSQHLFCEPQNLPRR
RSKVSCFVKALSAPHLFQQQPAASPIGARSFHFTVDGNKRSSAKVSDAISTQHPVVDHEF
DAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWH
FYDTVKGSDWLGDQDAIHYXXXXXXALVSQLENYGMPFSRTEDGKIYQRAFGGQSLKFGK
GGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDG
SIHRITSRLAHLSSRGYGRTYFSCTSAHTSTGDGTAMVTRAGRQIMRFVADIPSLGDSAL
LCLSPWDFLLLPRGGEATLTPLGLVLAMMAPWPSP

BLAST