GenomeNet

>ssc:780433 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) SDHA; succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1 (A)
MSGVRAVSRLLRARRLALTWAQQPAASPIGARSFHFTVDGNKRSSAKVSDAISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGSIHRIRARNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAVRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KVPSIKPNAGEESVMNLDKLRFANGTIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKI
LRLYGDLQHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKE
RVDEYDYSKPIQGQQKKPFQEHWRKHTLSYVDVKTGKVSLEYRPVIDKTLNEADCATVPP
AIRSY

BLAST