GenomeNet

>ssi:SSU0789 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; putative thymidine kinase (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDAFGVVSSRIGMRRDAV
AIDDDMDIFGFIEKMEPRPYCVLIDEAQFLRRHHVYALARVVDELDVPVMAFGLKNDFRN
ELFEGSQHLLLLADKLDEIKTICQYCSKKATMVLRTQDGKPTYEGEQIQIGGNETYIPVC
RKHYFSPEIKDLP

BLAST