GenomeNet

>ssl:SS1G_01550 K11419 histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
MAPTYRDHYFGHSVPSIKDCHWCQIRSFSNADKYPISIVCKDEHLTLPGDFTFIQKSILR
EGVSRADPEFRVGCECKNNCHGITCHCLQDSEVDLPDHNVYAYQAGGNSEGCLKEQLLGS
KAPIYECHEACACDETCDNRIVARGRRVPLQVFRTETRGWGVRSKVPIKAGAFIDCYIGE
IITSQEAERRRDNAIISKRKDLYLFNIDKFTDPDSLDETLRGDPYVIDGEFFSGPSRFFN
HSCEPNMNIFARVGDYSEKNLHDLAFFASEDIRPMTELTFDYVDGHDNGEEGSEKCLCGT
KSCRGWLW

BLAST