GenomeNet

>ssl:SS1G_02779 hypothetical protein; K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] (A)
MDLHFLKSPEEETSGRLGAPGLSKENSSTSDALTQMMRQEKSMDVIKESIGTSEEAMMED
WSLSLEALLEKRHLRTMIALDNDTLDDDESPFISLEAPDRHVQGAIKLNIQTTKKQRTPN
YALPIIVGDGGVERTPSYAHHTDVLRNHLTADDKILRYVPSVVQNEEKFMNKFEKDLHGL
YEERNDDPREREQIYQIDRHVDVFLENMGYDYCNREALIRYYLGHKHEKLPYPMEEKRLV
LKTLGGPLSGDELRIMGLVAEEMTAGCDIDMGDVVLSKSRFKVLVEDSKDKLYKLSGNQP
PPPERLGTMAGFSCLICHGAACTTHGEFKNNLSDGSSEIGSPDSSSSKKSNDDHKWKRFV
MYSSDVMRKHNARDHSNKNENWHPEHWNTEKDTAEACGEECYRGRTEWANHAWTQEEESE
LKSILLVTKPKKPCTLVDILDKPCWQIYSKILDLEEESSISRSKSLQKQQQSERAHWYDP
AAVPRNRGLKPGWRDSTVAHMAELRAQPGPCLHEGPCRRELNCYCVIHNLLCEQFCGCTE
DCVRRFAGCSCRSEGLACTSDTCICFQMNRECGDQCDTCGAIPRLRPQDRYNHELFQHGC
QNIALQRGVNKKLILGKSPIPNAGFGLFTAEPVKKGDFISEYTGEVISDKEADRRGVGYD
ARRLSYLFGLNKEWVIDATRMGNKTRFINHAKSEAGGTNCFARVLFVQGEYRIEFRATRN
ILIGEELLFDYGTSFAEIHDLNKKSGDGKGKTKGNKGTSNESSEKKSAKNGKIGEKRKVG
WPKGRPRPKASKKAKVHEYGVAGPSNAHSHSRSHSNSDQGVDDDSDEMMLDADSPLFPDM
IQDSDSADETFVGKLSDVEMRDAGNGDGGDGENEDEERVRRTSRTRTVPVRYTL

BLAST