GenomeNet

>ssl:SS1G_03342 K10777 DNA ligase 4 [EC:6.5.1.1] | (RefSeq) hypothetical protein (A)
MASSQQNKNKKPSPEAIADDERQYTYSTISKEELNDKYPDRPRNHGKTLPFHELFQSLFD
PLEANKNKKPGPAAARKKLGPHGPNTLSPNEIRKNIIVRFMSRWRSEVGDDFYPALRLII
PEKDRDRAMCYEVLSKRPMRQKVGDMTIGEANEMLDKLALAQKEEHQLPIFREFYQKMNA
EELVWLIRMILRQMKIGASEKTFLNLWHPDGEALFNVSSSLRRVCWELTDPNVTLEADET
GVELMSCFQPQLAQFMSNSFEKMVEKMCAQNPRDKGNGSEFWIEEKLDGERIQMHMEEDD
DIPGGRRFIWWSRKGKDYTYLYGNGFEDDNSALTRHMKNAFDPRVSSIILDGEMITWDPV
TNKMVAFGTLKTAAISGGKDPFSATAARPVFKVFDCLSEQVDVSLSSCKQRTHTNHKIGA
NPMKCFSFFKVGGGFNADDYAAIRHQTDGKWIKWDAKSPPTEFIELAGSHQEKERPDVWI
KPDDSIVMEVKAASVSISDSFRTNFTLRFPRFKRLRPDKDWKSALSIEGFMELKAKVEEG
EDDEFQVDKKKRNSKRLKRDKVIAGTEDDGKVLYEGPTTGVFEGMDFCILSDMILPVKKS
KAELETIIKNNGGRIYQSPSAKEDIIVIADKRVVKVASLIKSGKINIVKPQWVLHAVAQM
EIDAKLGRSRFVIPYETGHMLFTREENKESIAANSDQYGDPYCRDVGPEELRGIMDGMDL
NIDIRIAMNHFQFACGVFLHGEDGDTHVQKEDVTHIIFGDVSSERIRETKRELSGRTPHL
VSWKWIRDSWDTETRLDENGYLVEL

BLAST