GenomeNet

>ssl:SS1G_06534 K01312 trypsin [EC:3.4.21.4] | (RefSeq) hypothetical protein (A)
MAPILNFALALAMPILSMAAALPSGTELENRGTTLTGTVGIVGGTTAALGEFPYIVSLTY
AGSHFCGGVLLNAYTVLTAAHCSVSYSASSVKVRAGTLTWASGGTQVGVSKVVVHPSYNS
RTIDNDIALWHLSTAIPSSSTIGYAKLPVQGSDPVVGSTATVAGWGLLTENSSSLPATLR
KVSVPVISRSTCQAEYGTSSVTTNMWCAGVTGGGKDSCSGDSGGPIIDAATGVLEGTVSW
GQGCAEAGYAGVYSRVGNYVTYIQSSLWTSL

BLAST