GenomeNet

>ssl:SS1G_13713 hypothetical protein; K10747 DNA ligase 1 [EC:6.5.1.1] (A)
MPPKQATLGKFFGQPKGAPAKQSKLSFSSKSNSTKPPTSSSSASEENQDVEMKDGESDVD
TTDTVKKEEGSDAKEKVKKENVKQEKGVKRSRSPSPKLSAKTKAIKLDEEVKEEEDEDDD
EEPIVKKPRRAENAQAKERKPSPKTIAKKPKTKSEPESSPKEDASKNLSPTAKRGRKAKG
VEEGDEDEIEKTAQSPKLAKRRDSIVSKSASESEIEEDLESSGDEKPEVAAKAREKIQTT
LKSKGKDPYPDWKAGEPVPYAALCTTFSLVEMTTKRLIITAHCSLFLRQVLRLTPDDLLS
TVLLMINKLAADYAGIELGIGESLIMKAIGESTGRNLSVIKNDQKEIGDLGLVAVKSRSN
QPVMFKPKPLTVRAVLKSLIDIATVQGNGAQGRKVDGIKKLLSAADAHSSGKVDITKDKG
GASEAKYIVRFLEGKLRLGLAEKTVLVSLAQAMVCHEIEAKGSGKVPSTEQLANGESILK
AVHSYDVIIPAMLEHGIFSLKDNCKLQPGVPLKPMLAKPTKAITEVLDRFENQTFTCEYK
YDGERAQIHYVAKDSPKQYLGATPAAAKPSAGGLAAIFSRNSEDLSKKYPDILGKLNTWV
KEDTKSFVLDCETVAWDMVEKKVLPFQQLMTRKKKDVKVEDVKVKVCVFAFDLLFLNGEA
VVEKSLRERRALLHEAFQPVEGEFQFATSMNGQEIDEIQTFLDESVKASCEGLMVKMLDG
TESGYEPSKRSRNWLKIKKDYLSGIGDSLDLVVLGAYYGRGKRTSVYGAFLLACHNPHTD
TYETICNIGTGFSEQVLEELHAQLSAIVIDRPKPFYSHSSGNQHQPDVWFEPKYVWEVKT
ADLTLSPRYKAGCKEGVDKGGEKGISLRFPRFIKIRDDKKPDMATSSRQVAEMYRKQESV
TKSKGSSVDDDFEY

BLAST