GenomeNet

>sss:SSUSC84_0752 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; putative thymidine kinase (EC:2.7.1.21) (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDAFGVVSSRIGMRRDAV
AIDDDMDIFGFIEKMEPRPYCVLIDEAQFLRRHHVYALARVVDELDVPVMAFGLKNDFRN
ELFEGSQHLLLLADKLDEIKTICQYCSKKATMVLRTQDGKPTYEGEQIQIGGNETYIPVC
RKHYFSPEIKDLP

BLAST