GenomeNet

>ssx:SACTE_0551 DNA ligase D, 3'-phosphoesterase domain-containing protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MSSDGAQRFVVQIHDARRMHFDFRLEVDGVLRSWAVPRGPSDNPRDKRLAVPTDDHPLSY
RTFEGVIPADEQGGGTVIVWDQGTYRPLGHAPDGSPLPFGESLERGHATFWLDGAKLHGE
FALTRFRVGDEEVNPGPEAWLLIKANDRQAVRDRPGTPDPHHARSARSGRTLRQVALAEG
RGEDVG

BLAST