GenomeNet

>ssx:SACTE_0551 DNA ligase D, 3'-phosphoesterase domain protein (A)
MSSDGAQRFVVQIHDARRMHFDFRLEVDGVLRSWAVPRGPSDNPRDKRLAVPTDDHPLSY
RTFEGVIPADEQGGGTVIVWDQGTYRPLGHAPDGSPLPFGESLERGHATFWLDGAKLHGE
FALTRFRVGDEEVNPGPEAWLLIKANDRQAVRDRPGTPDPHHARSARSGRTLRQVALAEG
RGEDVG

BLAST