GenomeNet

>ssx:SACTE_0681 alkaline phosphatase D-like protein; K01113 alkaline phosphatase D [EC:3.1.3.1] (A)
MSYRPRVPAPGRRTVLRGTLLASAAAAVPTALTAAPALALSGRPNASWGVQVGDVTASSA
LVWVRSDRPARMLVETSATESFRRARTWRGPLLGTGTDFAGTVPLFGLPAGTQVHYRVTL
ADPFDPRRTGAPVYGTFRTAPAHRRDDVRFLWSGDIAGQGWGINPDIGGYRVYEEMRRLD
PDFFLCSGDTVYADGVLEPSVTLPDGRTWRNVTTPEKSKVAESLDEYRGNFRYNLLDTNA
RAFNAQVPSIVQWDDHEVRNNWYPGQILDDDRYTEKNVDVLAARSVRAFREYFPVSTLHG
AGREGRVHRVVRHGPLLDLFVLDMRSFRNANSPGRQPDDTTGILGAEQLSWLKRELSRSR
AVWKVIAADMPLGLVVPDGETDFEAVAQGDPGAPLGRELQIAELLRHIKHRRITGTVWLT
ADVHYTSAQHYLPEQAAFKDFAPFWEFVSGPLAAGQFPANALDGTFGPDQVFVRAPERPN
VSPMESPQLFGQVDIDGESGELAVSLRAQGGSVLFRKVLQPGRVGQ

BLAST