GenomeNet

>ssx:SACTE_1640 alpha amylase catalytic subunit; K01176 alpha-amylase [EC:3.2.1.1] (A)
MARRSLSASLALVTGAAVLALPAGLGTAGTAQAAPPGEKDVTAVMFEWKFDSVAKACTDS
LGPAGYGYVQVSPPQEHIQGGQWWTSYQPVSYKIAGRLGDRTAFANMVGTCHGAGVKVVA
DAVVNHMSSGSGTGTGGSSYTKYDYPGLYSVNDMNDCQSEINNYGDRANVQNCELVGLAD
LDTGEEYVRGKIAGYLNDLLSLGVDGFRIDAAKHMPAGDLANIKSRLSNPNVYWKQEAIY
GANEAVSPTEYLGTGDVQEFRYARGLKQSFLGGNLADLKNFGEGWGFMESGRSAVFVDNH
DTERNGETLNYKNGADYTLASVFMLAYPYGSPDVHSGYEWSDKDAGPPSGGQVNACYSDG
WKCQHAWTEISSMVGFRNAARGQAVTNWWDNGGDQIAFGRGSKAYVAINHEGSSLTRTFQ
TSLPAGDYCDVQSGKGVTVNGSGQFTATLGSNTAVALHTGARTCTGGGTTPDPGTGGSGA
SFGVAATTVLGQNIYVTGDQATLGDWNPGGALKLDPAAYPVWKLDVALPAGTSFAYKYLR
KDAAGNVTWESGANRTATVPSSGKVALTSDVWRG

BLAST