GenomeNet

>sta:STHERM_c06000 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) D-alanine-D-alanine ligase related protein (A)
MEEKVRDTDKPPERRRRRIPAARARCLGPLSDLESHVAPDWWSRIFNSYYMKTDGDVVDD
LAITRREVDLFTSVLDLREDEAVLDLCCGQGRHSLELARRGFTKVEGLDRSHYLIQRAKA
QAAKEGIPVRFREGDARKLPHPPDQFDVVMILGNSFGYFETSKDDLLVLKEVARVLKPWG
RVLLDLADGDFLRAHYVPRSWEWIDPKHFVCRERALSADRQRLISREVIVHTEKGVEVDQ
FYAERLYTPELIRSLLEEAGFQEVSFHGTLTPDSARGQDLGMMERRILVSARIRKEWTPV
KPKKKNVSTQVAVVMGDPSKPDPLKPFMVFDDDDFYTIDRLKAALKECTGYSFTYLSRHE
TLIQDLMRLKGKIDYVFNLCDEGFFNDPRKELHVPALLEMLGIPYTGATPQGLAFCYDKS
LVRGVAKEMGVPVPRAFFIDPTSIVFEVPFGFPMIVKPNLGDSSFGITQKSVVWSLDELS
ACISEIRDTFGYEKPVLVEEFLTGKDLTVGIIGNPPDDYMVLPIVEEDYSALPPELPRIC
GYEAKWLPDSPYWKALQSIPAGLPEATEKSIVEWCVRLFERLECRDYARFDWRCDADGNP
YLLEVNPNPGWCWDGHLAKMARLAGMEYPQMLQAILKAAERRLGIR

BLAST