GenomeNet

>sth:STH1986 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) anaerobic sn-glycerol-3-phosphate dehydrogenase subunit A (A)
MLQAIVIGGGATGAGILRDLALRSVRAALVEQGDLVHGTSSRYHGLLHSGGRYAVKDPES
ARECAVENQIVRRIAPFAVEPCGGLFVRLEQDDPAYARRWVAACREAGIPVEEVDPDRLR
REEPLLAGSVCEAWAVPDAAVDGWRLVRGNVAAAEARGARVFTYRRVVGLLMDGRRVAGV
RLLNLATGEEERLEAELVINAAGAWAGQIAAMAGAPLDVVADRGVLLVYHGRLTSRVVNR
LRKPGNGDIFVPAGSVTLLGTTATPVPDPDDISVPPEEVEELKRLGAEMLPMAATARILR
AFAGVRPLFGSGPGGNTREISRGFAVIDHEVEHGVPGLLSVVGGKLTTYRMMAEKAVDVA
AARLGVTVPCRTAEEPILPPPDPDAVRRLVHLVGRDLAQAVADRHPATLPQIAEAIARPG
GRQVVCECEQVTAGELVGTARELGAPSLGDLRRRTRLGMGTCQGGFCGYRAALLLAREGI
VAPEQVPALLARFQAERWRGVRGGLGGLELRAAELNYALARAQLAMEPAAGTADAVAQMG
GAGHD

BLAST