GenomeNet

>stl:stu0997 K16509 regulatory protein spx | (GenBank) conserved hypothetical protein (A)
MVTLFLSPSCTSCRKARAWLINHEVAFDERNIITSPLTHDELMNILSHTENGTEDIISTR
SKVFQKLNIDVDNLTIEELIQLISEYPNLLRRPIIMDNKHMQIGFNEDEIRAFLPRDYRK
QELRQATISAEIKGNND

BLAST