GenomeNet

>stl:stu0997 conserved hypothetical protein; K16509 regulatory protein spx (A)
MVTLFLSPSCTSCRKARAWLINHEVAFDERNIITSPLTHDELMNILSHTENGTEDIISTR
SKVFQKLNIDVDNLTIEELIQLISEYPNLLRRPIIMDNKHMQIGFNEDEIRAFLPRDYRK
QELRQATISAEIKGNND

BLAST