GenomeNet

>stn:STND_1517 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) D-alanine-D-alanine ligase-like ATP-grasp enzyme (A)
MSKQTLILLYGGRSAEREVSVLSAESVMRAVDYNAFEVKTYFITQSGDFIKTQEFIETPG
DDEKLMTNDTVEASQAIKPSDIYEEDAVVFPVLHGPMGEDGSIQGFLETLKLPYVGTNVL
SSSVAMDKIMTKRILEVAGVPQVAYTGYIEGEDLEAAVAETLEKLTFPVFVKPANMGSSV
GISKAENESELRSAIDLALKYDSRILIEQGVVAREIEVGILGNTTVKTTDPGEVVKDVAF
YDYQAKYIDNKITMDIPARVPVEVMTQMRAYAAKAFRALGGCGLARCDFFLTEDGAIYLN
ELNTMPGFTQWSMYPLLWENMGLSYSDLIKELVVLGQEMFDKRESHLI

BLAST