GenomeNet

>stp:Strop_1543 DNA primase, small subunit (A)
MGGTKAAAEEIKVAGQHVRLSSPDRVIFPQRGFTKADVFHYYLAVGPGIMRALGERPTTL
QRFPEGIEGEAFFQKRVPARGVPPWVRTAQISFPSGRKAAELCPADLAHVAWAAQMGTVV
FHPWPVRATDPDHPDELRLDLDPQPGTDFADAAKAATELRAILAELGVPGWPKTSGGRGV
HVYLRIQPRWTFVEVRRATIALARELERRRPDLVTTAWWKEERGARVFVDFNQMARDRTI
ACAYSLRANARATVSTPLAWDELADAEPDDFDLRSVPARLAEGGDPHAGIDDAAWDITPL
LEWVERDAANGQGDLPYPPEHPKMPGEPKRVQPSKDRDRPR

BLAST