GenomeNet

>stp:Strop_2686 alpha amylase catalytic subunit; K01176 alpha-amylase [EC:3.2.1.1] (A)
METARPHPIGRTGRLVLAAALVAVGGTAVVTAATTATSARAAVVLNDSEVTANLWQWNWD
SVAAACTDHLGPAGYGAVQVAPPQESVYLPNSADGVHPWYEVYQPVSYQLESRFGNREQF
ASMVSTCHDAGVRVYVDAIVNHMAGTNNPPGTRGYAGTEFSGYDYPAVPYSGWDFHRPGD
NCPTDGSINDWDNVAQVTSCELLSLADLYTEKEYVRDTIAGYLNDLIGLGVDGFRVDAVK
HIRKDDFAAILSRLDDTVAEGRRPYVAQEIFDGANNPDLQARAFIGNGDVLDFAYAKGIR
SAFQGSVAALQNIPNWNLDAPSANVFSMVTNHDLERDGVVLSYKDGTDYVLANYFALAYP
HGKPSVFDSFTWSDRNQSPPHDGGGYVTDAVCGGTWNCLTQSTGIKGMVGWANAARSVQS
TADFTVVNDNVIGFHRGDRAWIGINDSGATATATFTTGLADGDYCDVISGAAGGAGCTGA
TVSVTGGQATVSIPANDAVAIHVNARPGATPSPTVSPTGDPTDQIATTFTVSATPGADQD
VYAVGSISELGSWAPAAAVRLTPQGGNTYRGTIDLPPSTAVEYKFIKVTSGGEVTWESGE
NRSFTTPASGTFAVTETFRGDVVSGPAIASSFHATVYTYFGQNAFVIGNVAELGSWNPDN
AVALSAADYPVWRATVDLPPNTNIEYKYLKKNPDGSVTWESGANRSFTTPATGTNTNTDT
WR

BLAST