GenomeNet

>stp:Strop_2686 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) alpha amylase, catalytic region (A)
METARPHPIGRTGRLVLAAALVAVGGTAVVTAATTATSARAAVVLNDSEVTANLWQWNWD
SVAAACTDHLGPAGYGAVQVAPPQESVYLPNSADGVHPWYEVYQPVSYQLESRFGNREQF
ASMVSTCHDAGVRVYVDAIVNHMAGTNNPPGTRGYAGTEFSGYDYPAVPYSGWDFHRPGD
NCPTDGSINDWDNVAQVTSCELLSLADLYTEKEYVRDTIAGYLNDLIGLGVDGFRVDAVK
HIRKDDFAAILSRLDDTVAEGRRPYVAQEIFDGANNPDLQARAFIGNGDVLDFAYAKGIR
SAFQGSVAALQNIPNWNLDAPSANVFSMVTNHDLERDGVVLSYKDGTDYVLANYFALAYP
HGKPSVFDSFTWSDRNQSPPHDGGGYVTDAVCGGTWNCLTQSTGIKGMVGWANAARSVQS
TADFTVVNDNVIGFHRGDRAWIGINDSGATATATFTTGLADGDYCDVISGAAGGAGCTGA
TVSVTGGQATVSIPANDAVAIHVNARPGATPSPTVSPTGDPTDQIATTFTVSATPGADQD
VYAVGSISELGSWAPAAAVRLTPQGGNTYRGTIDLPPSTAVEYKFIKVTSGGEVTWESGE
NRSFTTPASGTFAVTETFRGDVVSGPAIASSFHATVYTYFGQNAFVIGNVAELGSWNPDN
AVALSAADYPVWRATVDLPPNTNIEYKYLKKNPDGSVTWESGANRSFTTPATGTNTNTDT
WR

BLAST