GenomeNet

>stp:Strop_3967 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA primase, small subunit (A)
MSDRLRVDVAGRTLELSNLDKVLYPATGFTKGEVIDYYTRVAPVLLPHLSDRALTRIRFP
NGVDGSSFFEKNAPAATPSWVRTETLPVPGSAKGRETIDYVVADELPTLVWLANLAALEL
HTPQWQIGAHPDLMVVDLDPGEPAGLRQGCQVALLLRERLADDGIEAYPKTSGKKGMQLC
CPIAGTQPADVVSGYARRIAQELERAHPSLVVSKMARKLRAGKIFIDWSQNNAAKTTVAP
YSLRAQSVPAVSTPLTWAEVEAGGAGKRPSVRPYAAAEVLTRVAEQGDLLAPLLAGGPEL
PG

BLAST