GenomeNet

>strp:F750_4841 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD; ATP-dependent DNA ligase clustered with Ku protein (A)
MTPITEVEGRRLTLSNLDKVLYPATGTTKGEVLHYYAATAARVMLPHLRDRPLSFLRYPD
GPEGLRFFTKNPPPGTPDWVRTAPVPRSDDPGARQVLAQDLPSLMWAANLVVEFHTHQWR
QDSPAVADRMVFDLDPGPPAGVVECCAVALWLRERLAGDGLSAYGKTSGSKGLHLLVPLE
PTPSGKVTAYAKKLAVEAQGALPELAVHRMTRALRPGKVFVDFSQNAAAKTTAAPYTLRA
KARPTVSAPVTWEEIEECGAPDDLVLLAGDMAARLERHGDLLAPLNDPGQAGALPGG

BLAST