GenomeNet

>stx:MGAS1882_0528 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) ppc; phosphoenolpyruvate carboxylase protein Ppc (A)
MIEETSKEGDGHLPLKKLESSNNQAIIAEEVALLKEMLENITRRMIGDDAFTVIESIMVL
SEKQDYIELEKVVANISNQEMEVISRYFSILPLLINISEDVDLAYEINYQNNTNTDYLGK
LALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRDAKAGV
INLEKWRQELYRYIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTTEYKNLA
QKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDKLAALYRTF
SLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQIQLTNQPAARMSS
SVGLNTSAWSSPASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGDLREVMQAVD
IFGFFLASIDMRQDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLLQQLMEEPRTLSS
AAVAKSDLLEKELAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEVGLVDQ
QRARVQIVPLFETIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIMLGYSDSNKDGGYL
ASGWTLYKAQNELTSIGEEHGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLT
EQGEIIENKYGNKDVAYYHLEMLISASINRMVTQMITDPNEIDSFREIMDSIVADSNTIY
RKLVFDNPHFYDYFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQNRIMF
PGWYGVGSAFKRYIDRAQGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLA
ESQDVRDVFYEILDEWQLTKNVILAIQDHDDLLEDNPSLKHSLKSRLPYFNVLNYIQIEL
IKRWRNNQLDENDEKLIHTTINGIATGLRNSG

BLAST