GenomeNet

>stx:MGAS1882_0857 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase protein Tdk (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAI
PISNDMDIFTFIAQLEEKPYCVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPEI

BLAST