GenomeNet

>stx:MGAS1882_1079 sodA; manganese superoxide dismutase protein SodA/SodM; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MAIILPELPYAYDALEPQFDAETMTLHHDKHHATYVANTNAALEKHPEIGENLEELLADV
TKIPEDIRQALINNGGGHLNHALFWELLSPEKQDVTSDVAQAIDDAFGSFDAFKEQFTAA
ATGRFGSGWAWLVVNKEGQLEITSTANQDTPISEGKKPILALDVWEHAYYLNYRNVRPNY
IKAFFEIINWKKVSELYQAAK

BLAST