GenomeNet

>stz:SPYALAB49_000536 phosphoenolpyruvate carboxylase family protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MPLKKLESSNNQAIIAEEVALLKEMLENITRRMIGDDAFAVIESIMVLSEKQDYIELEKV
VANISNQEMEVISRYFSILPLLINISEDVDLAYEINYQNNTDTDYLGKLALTIKDLAGKD
NGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRDAKAGVINLEKWRQELYR
YIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTTEYKNLAQKHGLELDNPKP
ITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDKLAALYRTFSLSSTLVQPNSE
VERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQIQLTNQPAARMSSSVGLSTSAWSSP
ASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGDLREVMQAVDIFGFFLASIDMR
QDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLLQQLMEEPRTLSSAAVAKSDLLEKE
LAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEVGLVDQQRARVQIVPLFE
TIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIMLGYSDSNKDGGYLASGWTLYKAQNE
LTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGN
KDVAYYHLEMLISASINRMVTQMITDPNEIDSFREIMDSIVADSNTIYRKLVFDNPHFYD
YFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKR
YIDRAQGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAESQDVRDVFYEI
LDEWQLTKNVILAIQDHDDLLEDNPSLKHSLKSRLPYFNVLNYIQIELIKRWRNNQLDEN
DEKLIHTTINGIATGLRNSG

BLAST