GenomeNet

>sub:SUB0870 tdk; thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYYKYGTMNSGKSIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAV
PITDEMDIFNYIDALDDRPYCVLIDECQFLSKKNVYDLARVVDELQVPVMTFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKAIMQLRMKDNRPIYEGEQIQIGGNETYIPVC
RKHYFHPPINED

BLAST