GenomeNet

>suj:SAA6159_01155 glpD; DNA-directed DNA polymerase III subunit gamma and tau; K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MALSTFKREHIKKNLRNDEYDLVIIGGGITGAGIALDASERGMKVALVEMQDFAQGTSSR
STKLVHGGLRYLKQFQIGVVAETGKERAIVYENGPHVTTPEWMLLPMHKGGTFGKFSTSI
GLGMYDRLAGVKKSERKKMLSKKETLAKEPLVKKEGLKGGGYYVEYRTDDARLTIEVMKR
AAEKGAEIINYTKSEHFTYDKNQQVNGVKVIDKLTNENYTIKAKKVVNAAGPWVDDVRSG
DYARNNKKLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAIPREGKAYVGTTDTFYD
NIKSSPLTTQEDRDYLIDAINYMFPSVNVTDEDIESTWAGIRPLIYEEGKDPSEISRKDE
IWEGKSGLLTIAGGKLTGYRHMAQDIVDLVSKRLKKDYGLTFSPCNTKGLAISGGDVGGS
KNFDAFVEQKVDVAKGFGIDEDVARRLASKYGSNVDELFNIAQTSQYHDSKLPLEIYVEL
VYSIQQEMVYKPNDFLVRRSGKMYFNIKDVLDYKDSIIDIMADMLDYSPAQIEAYTEEVE
QAIKEAQHGNNQPAVKE

BLAST