GenomeNet

>suk:SAA6008_01522 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) sodA; superoxide dismutase Mn/Fe family protein (A)
MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANL
DSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVVEKIKEQWGSLEEFKKEFADKA
AARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIG
AFWNVVNWEKVDELYNATK

BLAST