GenomeNet

>suk:SAA6008_01522 sodA; superoxide dismutase Mn/Fe family protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANL
DSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVVEKIKEQWGSLEEFKKEFADKA
AARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIG
AFWNVVNWEKVDELYNATK

BLAST