GenomeNet

>sur:STAUR_6997 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD; ATP dependent DNA ligase (A)
MKTPRSLRTYRAKRDFQKTSEPAPEAKAPRRRGAPPLFVVHKHDATRLHYDLRLEIDGAL
ASWALPKGPSFDPKTKRLAVETEDHPLAYAGFEGRIPEGEYGGGDSLLWDRGTYETVPPG
EAPEQRKKGHLTVQLHGEKLKGRWHLIRTKSRGKKAQWLCFKAMDGEADADYDVTADRPE
SVKSGRSATRGPVRKGALKSRPLPAEQLLERVWPPMLAQLSVPTEADDATHLYEVKYDGF
RALAALSSGALTLHSRNGHDLSGRFPQLAEALRQLRVTEAVLDGEIIALDPQGRSRFQLL
QKGSDAEQRFVAFDLLWLDGEDLRPRPLEARRELLEQLLSGVKPPLQLSERLDLPGDEAL
AKARSQGWEGLIAKRRGAPYVGSRSRDWLKLKVQAAQETVILGYLPIQNARAREEIGALL
VGVHGPDGYHDVGKVGTGFSSETRRELRALLDRQRVRAPVAVDAKPRPGAVWVKPKYVAQ
VHFTEWTHDGRLRHPVFQGLRTDKKPQEVVREQVSEPRKAAQKSKAAPKSGARRAPRAFS
ARATRSQVQEEPAEAEGRARLTHGDRVLYPQERLTKQDVFAYYREAAPLLLPVLANRPLA
VQQWPAGIQAPGFFRHELSGMPAWLPTLRVKHEAKTLAHVNVQSLEALLWLANQSALTLH
IWSSHAPKLAQPDWVVFDLDPGKGPWEDVITVAQALREKLEALGLESLPKTSGKRGLHVL
IPLAPGHTYAQTQRFAEKIAAELETELGSLATTERTIQKRRGRLYLDVGQNGRGKTVVAP
YSLRAIPGAPFSAPLAWSEVTRKLDPLRFTLKTLSKRLDAVGDLFARALHGTQTLP

BLAST