GenomeNet

>sur:STAUR_7137 alpha amylase catalytic region; K01176 alpha-amylase [EC:3.2.1.1] (A)
MGCRHAPPAPPAAPAIEAAPAPAPTAPAPASRPWADEVLYFVVVDRFADGDPAHNVPGDV
SAPGTFHGGDLKGLTQQLDELTSLGITALWITPVVKNIDGFVTGSGFPDWGYHGYWADDF
HAMDPRFGTEEELRTLVKEAHARGIRVLLDVVYNHTGYGSRYLKMPETKDWLRSEETGTC
GQDNNITSCVAGLPDFKTERPEVAQYLIDAQIAWAKRSGVDGFRLDTLKHLEHGFWQEHR
RRTREALGPDFFLLGELWGGELASLDKYFVGDEVDAGFDFSFQGSTLAFLLGRGRTVAFD
RYLQSRGKIRPGYHLSHFLSSHDVPGALFQLGGDKVRFQLAAVLQLTTAGIPTIYYGEEV
ARPGGDWPANRDDMPWGARDVKPGAGKPRDEALRKTYQKLISIRRAHPALSRGTHRGLST
DGDLYVFLRHDAASGDAVMVAVNRGQTPASVSLPWPEAWGTPAAEDLLNGGRLEGPTLEL
AVEPLSARILGKPG

BLAST