GenomeNet

>sus:Acid_5076 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) conserved hypothetical protein (A)
MLPAEENEIELTLGRKKLRLTNLQKLFWHEPRITKRDLLQYYVDISPYLLPHLKDRAMVM
KRYPNGSEGEFFFMKRAPEPRPSWIRTCPIEHASGSVIDFPIIQDAGCLLWVVNLGCIDL
NPWYARCDDVQRPDYLHFDLDPVPGAEFERVLETALRVREALEERGIASYPKTTGSRGIH
MYVPIKREPVQKEVWTFAKKLAFELAAQYPDLITAEYRIAKRPAGRVLVDYNQNAWGRTL
ASVYSVRPRPRAPVSTPVTWEEVERGFRMEDFRIDNMAERVRKMGDLWHPLVMQRGRLKL
ERVS

BLAST