GenomeNet

>sus:Acid_6378 excinuclease ABC subunit B; K03702 excinuclease ABC subunit B (A)
MGFRLAVTYEPRGDQVNAIAELTRGLREGEQHQVLLGVTGSGKTFTMAKVIEAVNRPALV
LAHNKTLAAQLYHEFKTFFPENAVEYFVSYYDYYQPEAYIPASDVYIEKDATVNDELDKL
RLAATKSLFERRDCVIVSSVSCIYGLGSPEAYYGMLLMLEKGQKISRNQIVTRLVEILYD
RNDADFRRGTFRVRGDVIEVYPTYDDDAYRIELWGDEIENLSQIDPLLGQVKQTYQRLPI
YPKTHYVMSAETKEDAMQSIRNELEWWHKELVNQGKAIEAQRLFQRTMFDLEMMKEIGYC
HGIENYSRHFSGRLPGEAPPTLLDYLPNDAVMFLDESHQTVPQLHGMYHGDRSRKEVLVA
HGFRMPSALDNRPLTFEEFEHRVNQLVYVSATPGPYELTKSSGVVVEQIIRPTGLLDPTV
EIRPVKGQVDDLLGQIRARVENNQRILVTTLTKRMAEDLSEYYSEVGVRCRYLHSEVTTL
DRIKILRDLRRGEFDVLVGINLLREGLDLPEVSLVAILDADKEGFLRSWGALIQTIGRAA
RHVEGHAILYADVMTDSMRKALAETARRRQTQIEYNEENHITPQSIIKAIDMSLVAVAEG
DYVTVPLEDDPEVEDLTPDQRLRFIGELEERMREAARKFEFERAAQLRDRVKALKAVGG

BLAST