GenomeNet

>sus:Acid_7928 K13953 alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1] | (GenBank) Alcohol dehydrogenase GroES domain protein (A)
MKAAILPAARAAVTVEPIHLGEPAPGEVLLRMEACGICHSDLFVCGLEKLPLAPLTLGHE
GIGRVEAVGPDVTEWSAGDRGGVTFLGTTCGTCEWCRAGRERFCPRQTNFGYTLQGALGE
YAMVPASSLVRVPEDIAAVDAAPLCCAGWTAYGALREAGLRAGQSVALFGYGGLGHLALQ
IARHQGLRVAVADPTEEKIAMARADGAEGETRNADAAIVFTAAAAAIPQAFKALRRNGTL
ILVGLATTTYELPLVDTVLKGITIRGSYLGSREDLAAVFGLARQGVLRPHVHQHGLEETP
ALLEQMRRGALAGRAVITF

BLAST