GenomeNet

>sut:SAT0131_02282 Thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
PRCRAHHIVAPSDNNKEEL

BLAST