GenomeNet

>suw:SATW20_20610 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (GenBank) phage ATP-dependent DNA ligase protein (A)
MQELYEILQEIKNTNSKTSKENILRKHKDNELLTETLKFLFDDLIVTGISSKKIAKPINP
MTINNIDLMKLFEYLRSNNSGKDKDIAYAKGMINNARKVFGTDVADMVKGIIIKDYPIGI
SKVTINKVFGKGFIFKFDVRKGSKFEGKLKPNVQYAQSTKLDGVRSVVLVNDKGVQIFGR
SGKTIDDLKEIEALFNKYYEQTNTPMMFDGELLAIDETESIPNDELFRITSKILRVKGDK
SDIKFVMFDNMPLEEFYEGKSKLKFKERRDNLLAFYEQLKVIDPKVIDIVPIHYIGNDMA
EIQSVQKKLEDSGFEGSMLDEIDAYYEAKRTKSLLKFKTFHTVDLRCLRVEEHVRGNKVG
NIVVDYKGYELGVGSGFSDKDRKLFWEQKDLIEGKIVEISYFEESKNDKGGESLRFPVFK
MVRNDKDEVSLN

BLAST