GenomeNet

>suw:SATW20_20610 phage ATP-dependent DNA ligase protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MQELYEILQEIKNTNSKTSKENILRKHKDNELLTETLKFLFDDLIVTGISSKKIAKPINP
MTINNIDLMKLFEYLRSNNSGKDKDIAYAKGMINNARKVFGTDVADMVKGIIIKDYPIGI
SKVTINKVFGKGFIFKFDVRKGSKFEGKLKPNVQYAQSTKLDGVRSVVLVNDKGVQIFGR
SGKTIDDLKEIEALFNKYYEQTNTPMMFDGELLAIDETESIPNDELFRITSKILRVKGDK
SDIKFVMFDNMPLEEFYEGKSKLKFKERRDNLLAFYEQLKVIDPKVIDIVPIHYIGNDMA
EIQSVQKKLEDSGFEGSMLDEIDAYYEAKRTKSLLKFKTFHTVDLRCLRVEEHVRGNKVG
NIVVDYKGYELGVGSGFSDKDRKLFWEQKDLIEGKIVEISYFEESKNDKGGESLRFPVFK
MVRNDKDEVSLN

BLAST