GenomeNet

>suz:MS7_1739 K01895 acetyl-CoA synthetase [EC:6.2.1.1] | (GenBank) hypothetical protein (A)
MKVEVYKGAQGKHNLKDYEEIYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
IALNYKDEYRKESYTYKDMQRLSNKAANVLSEHAEVAKGDRVFIFMSRTPELYFALLGVL
KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTGQPKGVLHVQQAMLVHYISGKYVL
DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVMKWAKKVYGLTVLDTWWMTETG
GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRLFVKEGLSAHAAPREIEFKDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTME

BLAST