GenomeNet

>suz:MS7_2609 K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] | (GenBank) aminotransferase class-III family protein (A)
MSKAHQLIQEDEHYFAKSGRIKYYPLAIDHGYGATLVDIEGKTYIDLLSSASSQNVGHAP
REVTEAIKAQVDKFIHYTPAYMYHEPLVRLAKKLCEIAPGDFEKRVTFGLTGSDANDGII
KFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKHYGPLLNGFYHIPFPDKYRGMY
EQPQANSVEEYLAPLKEMFAKYVPADEVACIVIETIQGDGGLLEPVPGYFEALEKICREH
GILIAVDDIQQGFGRTGTWSSVSHFNFTPDLITFGKSLAGGMPMSAIVGRKEIMNCLEAP
AHLFTTGANPVSCEAALATIQMIEDQSLLQTSAEKGEYVRKRMDQWVSKYNSVGDVRGKG
LSIGIDIVSDKKFKTRDASAALKICNYCFEHGVVIIAVAGNVLRFQPPLVITYEQLDTAL
NTIEDALTALEAGNLDQYDISGQGW

BLAST