GenomeNet

>sve:SVEN_0608 ATP-dependent DNA ligase (EC:6.5.1.1); K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MTPTSRTAPPERVRAGRRTVEIRRPDKVLFPGDGLTKADLAGYYRTVAHRMLPHLRGRPL
MLERHPDGIDGPAFMQKDVPDHFPDWVHRAELPKEGGTVTYVLCEDTATLLYLAGQACTT
PHRFLSRADRPDRPDRLVFDLDPADEDFAPVREAALGLHRLLDELELPSSLMTTGSRGLH
VVVALDRRAPFDDVRAFARGVADVLASRHPDRFTTEARKNARRGRLYLDVQRNGYAQTAV
VPYAVRARPGAPVAAPLAWSDLDDPDLTARRWTVATVDGLLKDDPWHDPPRPRSLRRARD
LLAELTRGG

BLAST