GenomeNet

>sve:SVEN_0608 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP-dependent DNA ligase (A)
MTPTSRTAPPERVRAGRRTVEIRRPDKVLFPGDGLTKADLAGYYRTVAHRMLPHLRGRPL
MLERHPDGIDGPAFMQKDVPDHFPDWVHRAELPKEGGTVTYVLCEDTATLLYLAGQACTT
PHRFLSRADRPDRPDRLVFDLDPADEDFAPVREAALGLHRLLDELELPSSLMTTGSRGLH
VVVALDRRAPFDDVRAFARGVADVLASRHPDRFTTEARKNARRGRLYLDVQRNGYAQTAV
VPYAVRARPGAPVAAPLAWSDLDDPDLTARRWTVATVDGLLKDDPWHDPPRPRSLRRARD
LLAELTRGG

BLAST