GenomeNet

>sve:SVEN_5000 hypothetical protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MSRAPDGIRGDHGAGAGAGAGVGAGVGSWGPSGAAGAGGPEGGGGAGPARNGGPGRASAA
PAASARGPEGGSGDPADGPGPARDPGRAGRGPAAGRGGLVVHPPVGVMRPRAADELPPQA
APPRELQYSLKLDGFRALAFVLDDGKVVLQSRSRRDLAPEFPGIAAHLADQLPPGVVLDG
ELCAYRDGRLSFTDLLRSPADRARAGVPVSYIAFDLLAVPGRDVRGLPLRTRWELLGAAL
SEAEPPLQRVLATLDEETARGWFRDLQDAGVEGIVAKTLSSTYRAGSTWAWRKIRHTDTS
DGLLLGVVGPPGRPRSLLVRLADGRTVPTAPRLTPAQSREVGALAGDRAGPLVQDPEHGP
VRWVDPPLPVELRQLAVRQRQDYATFIRVRSEG

BLAST