GenomeNet

>sve:SVEN_5000 no KO assigned | (GenBank) hypothetical protein (A)
MSRAPDGIRGDHGAGAGAGAGVGAGVGSWGPSGAAGAGGPEGGGGAGPARNGGPGRASAA
PAASARGPEGGSGDPADGPGPARDPGRAGRGPAAGRGGLVVHPPVGVMRPRAADELPPQA
APPRELQYSLKLDGFRALAFVLDDGKVVLQSRSRRDLAPEFPGIAAHLADQLPPGVVLDG
ELCAYRDGRLSFTDLLRSPADRARAGVPVSYIAFDLLAVPGRDVRGLPLRTRWELLGAAL
SEAEPPLQRVLATLDEETARGWFRDLQDAGVEGIVAKTLSSTYRAGSTWAWRKIRHTDTS
DGLLLGVVGPPGRPRSLLVRLADGRTVPTAPRLTPAQSREVGALAGDRAGPLVQDPEHGP
VRWVDPPLPVELRQLAVRQRQDYATFIRVRSEG

BLAST