GenomeNet

>svi:Svir_20210 DNA polymerase LigD-like ligase domain-containing protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MISRGLFRGILCRRLGIGTVVAVGTVALESPAVVLEGLLYLGDSAALETIHAEYENMAPP
TPLPPMLAVSGDVPEGDQWVYDWKWDGVRAIVGIEGGEVRVHSRALRDITSRYPELQELA
AATRARLLLDGEIVALDEQGRPDFDRLQSRMQVGLPTPRMLRESPLYYYVLDLLVADGEN
LCGSSYRHRRDRLAELGLPAPPTIRPPDPHARISGSGLLDIAAEHGFEGIMAKRLDSPYR
PGVRSTDWINTPLRIRQEVVIGGWVPGRSRHAGTLGTLLLGAYDPSGALSYIGHVETGRP
DPSSEALLGKLEALTRPSSPFATPVPRRRARHARWVEPELVGEVEHRRWTNDRTLWRPSW
QGLRTDREPAEVTLPV

BLAST