GenomeNet

>svi:Svir_34930 DNA polymerase LigD, polymerase domain-containing protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MTTMTQPVDIEGRRLELSNLDKILYPEHGFTKGELIDYYARVAPVLLPHVRDRPLTLKRY
PDGVEGKSFFEKNVSTHAPDWVRTVPIETPESSHSRKSADFALVQDLSTLVWAANLASIE
LHIPQWTVGPRGERRNPDLLVFDLDPGAPATIVDCCEVALWLRDELTDDGLTAYPKTSGS
KGLQLYAPVQTRSDDRTNDYAKRVAEKLERRHPRRVVSRMAKKLRVGKVLIDWSQNNPKK
TTVAPYSLRARSAPTVSTPVTWSEVEACENPAELGFVADEVLDRVDEHGDLFESLLTRAR
PSL

BLAST