GenomeNet

>svl:Strvi_1368 ROK family protein; K00886 polyphosphate glucokinase [EC:2.7.1.63] (A)
MTQDQGATGASAAKVFGIDIGGSGIKGAPVDLNRGELVEERHKVLTPHPSTPEAVLDGVV
EVVRHFDWSGRPVGVTFPGVVKNGVTLTAANVDKSWIGTDLASQLGERLDCPVTVLNDAD
AAGVAEVAFGAARGVKGTVIVLTLGTGIGSALFTDGHLLANTELGHLELDGHEAEKRAST
KVKDDHELSWSHWARRVQKYLHHLEMLFSPERFVLGGGVSRKADKFLPLIEGVRAEIVPA
QLQNNAGIVGAAMAAAAAADDAG

BLAST