GenomeNet

>svl:Strvi_2597 laminin G sub domain 2; K01186 sialidase-1 [EC:3.2.1.18] (A)
MLLTAAALALIPLPVRAADTDSSASAARADSGFEQQVLFKSAQEQGYSCFRIPAIVKAKD
GSLLAFAEGRVDNCGDAGDIDLVLKRSTDGGRTWGPLQVINEGGGDTHGNPAPVVDLRTG
RIVLASTYNTGRDDSQSCDVPCDRSPHLQYSDDNGATWSAPRDLSSSLMPPQWNSWYATG
PVHGIQLQRGRHKGRLLFTLNTESYSGGRITDNHAALAYSDDGGNRWRIGAMDTYPLTED
GTFRQKPSEMTLVERADGSVYVSGREQDGTDLGHRDYAISRDGGQSFTGPFRTIPDLPTP
QVQGSILRLRDPARDGHSRLLFSAPADPDRRRTMMVRSSWDEARTWDGVERGKVVTTDWS
GYSDMVAVSRDTVGLLYEGGAVDARDEIRFARFTEDWLGPRQAPAPTTDDRASGARSATV
LGGAAARGDGRFGGGMSFDGTDDAVRVPYRTALPLGTRDFTVSLWFRYSAASGQHPFLWM
GGIGTKQPQVWLRGEPGSNRIRALMTTVNGFSTFTSASVSSDAAYNDGQWHHLALTRSGG
RLSLTVDGGTAVTAPDAPGTVSRTAPFGLHLGQAVDGRSHMTGDLDEFRLYGRALTDTEL
RRVREFNAPLDDSGALVHLPLDRVRSSHH

BLAST