GenomeNet

>svl:Strvi_3580 DNA polymerase LigD, polymerase domain protein (A)
MAESVELTVGGRTVRVTNPGKVYFPERGFTKLDLARYYLAVGEGALRALRDRPTTLERYP
DGVDGESFFQKRAPKNLPEWIPTGRISFPSGRHADEICPTETAAVVWAANLGSLTFHPWP
VRREDTEHPDELRIDLDPQPGTDYEDAVRAAEELREVLDGLGLRGWPKTSGGRGLHVFVP
IAPEWTFTQVRRSAIAIARELERRAPERVTTKWWKEERGRKIFVDYNQTARDRTIASAYS
VRPRPHAPVSAPLRWAEVPDARPRDFDLATMPVRYRELGDVHADMDEHAFRLESALELAT
RDEQEHGLGDLPYPPEHPKAAGEPKRVQPSRAKK

BLAST