GenomeNet

>svl:Strvi_5102 K01190 beta-galactosidase [EC:3.2.1.23] | (GenBank) glycoside hydrolase family 2 sugar-binding protein (A)
MAVTRRSILIAGTAAPMAGALVTANPAQGALASRAMGGRTIPLTDGWRFALVNPGGITDP
TGAYETAHDPAYDDSAWREVAVPHDWSIELSPTTDHGTSGGTGFLPGGLGWYRTTFTLPR
TLEGKRICVEFDGVYMDSSVYCNGRPLGEHPYGYTGFALDLTEVAHTDGATPNVLAVKVR
NRLPSSRWYSGSGIYRHARLVVTDPVHVARWGTYLTTPGLATALRAGYATVRARTLVVNA
SDGPKPVTVVSTVKDPDGHTVVQAHSTVTIGAGDTRTATQELRIDRPRLWSFDTPERYVL
ETELRVGQDTTDRYRTPFGLRHVTLDPDRGFSLNGEYAKLQGVDLHHDLGALGAAVNTDA
VLRQVAIMKSMGVNALRTSHNPPSPELIEVCERLGIVMLVEAFDCWRTGKNTYDYGRFFD
EHCEADITEMVRAARNSPAVVMWSIGNEIPDSTSAPGLGMAQRLIDAVRAADDTRPVVIG
SDKYRGLPAEGSPADLMLAKLDGLGLNYNTAASVDALHARYPRLFLFESESSSETSTRGA
YQEPEHLNTGENHTPGRRETSSYDNNLASWTMSGEYGLKKDRDRRFFAGQFLWSGIDYIG
EPTPYDVFPVKASFFGAVDTAGFPKDMYYLFKSQWTGEPMVHLVPMDWTGHRPGETVEVW
AYSNVASVELFLDGRSLGVREFDAKKTTDGRAYLETTEPTGDDKTVTSGPYPGSYTSPGG
SAGKLHLTWKVPFARGELKAVARRGGRVVATDVLRTAGRPHTVRLTPDRESVDADGRSLC
FVTAEVVDAHGVVVPDAGHPIAFKVTGGSLAGVDNGRQESAERYQASTRTAFHGKALAIV
RSGTEAGPLTITARSAGLRTATTTVRATGGTSQPVTRPVPFAPDPGPGAPDQPRADASYS
GAPTTLPAAMLDGDPATGWSNAFHKPATALLPAFDGARKADWVSVTWSGRRRLRRVEVSF
TVDATHTLPASIEVSAWNGHAYVPVRGASVDWATASGTPTVITFDPVRTSRLRLDLTSRH
PGAADGAQRIVAFEAR

BLAST