GenomeNet

>svl:Strvi_7302 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) alpha amylase catalytic region (A)
MAGNRIPLATALALAAGSVALFALPPQTAQATPPGTKDVTAELFEWRYDSVAKECTSTLG
PAGYGYVEVSPATEHIQGGQWWTSYQPVSYKIAGRLGDRTAFKNMIDTCHSAGVKVVADA
VINHMSAGSGTGTGGSSYTKYDYPGIYQAQDMDDCTSQISNYQDRWNVQHCELVGLADLD
TGESYVRTRIAQYLNDLLSLGVDGFRVDGAKHIPTEDLAAIKSQLSDPGVYWKQEVIYGE
GEAVSPTEYLRNGDVQEFRYGRDLKRVFQGEKLANLKNFGEGWGYMASGQSGVFVDNWDT
ERNGSTLTYKNGADYTLANVFMLAWPYGSPDVHSGYEFGDNDAGPPNGGTVGACYQDGWK
CQHKWPEIMSMVALRNTARGASVTNWWDNGNNAIAFGRGDKAYVAINHESGSLTQTFQTS
LPAGGYCDVQSGKAVTVDSAGKFTATLGANTAVALHVGARNCG

BLAST