GenomeNet

>swi:Swit_3619 Glutathione S-transferase, N-terminal domain; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MTLSIHIGNKVYSSWSLRGWLAVRQSGLPFREVVAPLYDDSWDERRQTPEFAPSNGKVPI
LWDGDTPVWESLAIIDYLADKVGRDRFWPADDAARAFARSIASEMHAGYQALRSQCGMNL
RHVYPPEPLAPEVEADVRRITSLWDQAKRRFGQGGDYLFGGFGAVDIMFAPVVTRFRTYS
IPLPSLASDYCAAVWDHPFMVDWSCGAAGESWVIEKFERAAEKA

BLAST