GenomeNet

>swi:Swit_4139 alanine racemase domain-containing protein; K01775 alanine racemase [EC:5.1.1.1] (A)
MNCLEVHRDIGVHEVADRRGNAFQLDERAFHANVEQVRRLLPPGTKIYQCAKGDGYGVGV
ERIVCLGVRAGVDGFCLGTPEEALRAKCVAAGRPVLLFAGCDPAALGEMVEAGIIVSISS
VEGCEALLRSGATGDVFFKLDCGFRRYGLNEPDLRTVLARVRRQSSVRCIGAYSHFGSRA
DEIVDGGLPLFDRLTRLIEDAVQRPIETMVASSTLILQRPGLGHSAVDPGRLLYGMMAAG
PEMPPFQPIVPRISSRLLQVTPFDEARLLTVGYADKTAIPAGGATGVFPLGWIDGLSAHR
GFGEVLIRGTRLSVVARTLQHSIVNLSGLSDVRVGDEVVLVGAQGDEQIGLEAMASAQGM
SVTEAHFRLLAAIAAGVPNGRQHG

BLAST