GenomeNet

>swi:Swit_4139 K01775 alanine racemase [EC:5.1.1.1] | (GenBank) alanine racemase domain protein (A)
MNCLEVHRDIGVHEVADRRGNAFQLDERAFHANVEQVRRLLPPGTKIYQCAKGDGYGVGV
ERIVCLGVRAGVDGFCLGTPEEALRAKCVAAGRPVLLFAGCDPAALGEMVEAGIIVSISS
VEGCEALLRSGATGDVFFKLDCGFRRYGLNEPDLRTVLARVRRQSSVRCIGAYSHFGSRA
DEIVDGGLPLFDRLTRLIEDAVQRPIETMVASSTLILQRPGLGHSAVDPGRLLYGMMAAG
PEMPPFQPIVPRISSRLLQVTPFDEARLLTVGYADKTAIPAGGATGVFPLGWIDGLSAHR
GFGEVLIRGTRLSVVARTLQHSIVNLSGLSDVRVGDEVVLVGAQGDEQIGLEAMASAQGM
SVTEAHFRLLAAIAAGVPNGRQHG

BLAST