GenomeNet

>swo:Swol_1124 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) conserved hypothetical protein (A)
MGESATIAMAGREIKLTNLDRVLWPEDGYCKRDLVEYYTAIFPYMLPHLSERPLVFTRYP
RGIGEKSFYQKNAPEGLPQWIKTFTWAGSDGDSKNYVLVQQTVDLMWLANLACIEIHPWL
SQINSIEYPDFIVFDLDPSEQSTFEQVISVARLLHELMDSLSLRVYPKTSGAKGLHLYLP
IAEGFTYSQIRRVAQAMAEMVCQVIPDIATTERALKHRGPRVYLDYLQNGLGKTVCAAYS
VRPHKGAPCSTPIEWQELESIRPDQFTIKTLPERLQQVGDLFADVLNDRQDLKKAMATLG
VSR

BLAST